Rabbit Polyclonal Anti-AAK1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-AAK1 Antibody: A synthesized peptide derived from human AAK1 |
Rabbit Polyclonal Anti-AAK1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-AAK1 Antibody: A synthesized peptide derived from human AAK1 |
Rabbit polyclonal anti-AAK1 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human AAK1. |
Rabbit Polyclonal Aak1 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Aak1 antibody was raised against a 20 amino acid peptide near the amino terminus of the human Aak1. |
Rabbit Polyclonal Aak1 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Aak1 antibody was raised against a 18 amino acid peptide near the carboxy terminus of the human Aak1. |
Goat Anti-AAK1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-GSPRTSQQNVYNPSE, from the internal region of the protein sequence according to NP_055726.3. |
Rabbit Polyclonal Anti-AAK1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-AAK1 antibody: synthetic peptide directed towards the C terminal of human AAK1. Synthetic peptide located within the following region: SGFDVPEGSDKVAEDEFDPIPVLITKNPQGGHSRNSSGSSESSLPNLARS |
Aak1 Antibody - C-terminal region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |