Antibodies

View as table Download

Rabbit polyclonal anti-CNN2 antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CNN2.

Rabbit Polyclonal Anti-CNN2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CNN2 antibody: synthetic peptide directed towards the N terminal of human CNN2. Synthetic peptide located within the following region: MSSTQFNKGPSYGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDF

Goat Anti-Calponin 2 / CNN2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DPGEVPEYPPYYQEE, from the internal region (near C Terminus) of the protein sequence according to NP_004359.1; NP_958434.1.

Rabbit Polyclonal Anti-CNN2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CNN2 antibody: synthetic peptide directed towards the N terminal of human CNN2. Synthetic peptide located within the following region: YGLSAEVKNRLLSKYDPQKEAELRTWIEGLTGLSIGPDFQKGLKDGTILC

Carrier-free (BSA/glycerol-free) CNN2 mouse monoclonal antibody, clone OTI2B5 (formerly 2B5)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

CNN2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human CNN2

CNN2 mouse monoclonal antibody, clone OTI2B5 (formerly 2B5)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated

CNN2 mouse monoclonal antibody, clone OTI2B5 (formerly 2B5)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Conjugation Unconjugated