Rabbit Polyclonal LIF Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | LIF antibody was raised against a 16 amino acid synthetic peptide near the center of human LIF. |
Rabbit Polyclonal LIF Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | LIF antibody was raised against a 16 amino acid synthetic peptide near the center of human LIF. |
Rat Monoclonal LIF Antibody (39N7D10)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Rabbit polyclonal anti-leukemia inhibitory factor (LIF) antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E. coli-expressed recombinant human LIF |
Rabbit Polyclonal Anti-LIF Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LIF antibody: synthetic peptide directed towards the N terminal of human LIF. Synthetic peptide located within the following region: KVLAAGVVPLLLVLHWKHGAGSPLPITPVNATCAIRHPCHNNLMNQIRSQ |
Anti-LIF Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 34-47 amino acids of Human leukemia inhibitory factor |
LIF Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 23-202 of human LIF (NP_002300.1). |
Modifications | Unmodified |
LIF Rabbit polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from the C-terminal region of human LIF. AA range:141-190 |