Rabbit polyclonal Anti-NaVBeta1 (extracellular)
Applications | IF, IHC, WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide CKRRSETTAETFTE, corresponding to amino acid residues 43-56 of rat NavÃ?1 . Extracellular, N-terminus. |
Rabbit polyclonal Anti-NaVBeta1 (extracellular)
Applications | IF, IHC, WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide CKRRSETTAETFTE, corresponding to amino acid residues 43-56 of rat NavÃ?1 . Extracellular, N-terminus. |
Rabbit Polyclonal Anti-Scn1b Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Scn1b antibody is: synthetic peptide directed towards the N-terminal region of Rat Scn1b. Synthetic peptide located within the following region: TFRQKGTEEFVKILRYENEVLQLEEDERFEGRVVWNGSRGTKDLQDLSIF |
Rabbit Polyclonal Anti-SCN1B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SCN1B antibody: synthetic peptide directed towards the middle region of human SCN1B. Synthetic peptide located within the following region: NVTYNHSGDYECHVYRLLFFENYEHNTSVVKKIHIEVVDKANRDMASIVS |
Rabbit Polyclonal Anti-SCN1B Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SCN1B |
SCN1B rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human SCN1B |
SCN1B Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 19-160 of human SCN1B (NP_950238.1). |
Modifications | Unmodified |