USP9X Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human USP9X |
USP9X Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human USP9X |
Rabbit Polyclonal USP9x Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Genomic peptide made to an internal region of the human Usp9X protein (within residues 1150-1300). [Swiss-Prot Q93008] |
Rabbit Polyclonal Anti-USP9X Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-USP9X antibody: synthetic peptide directed towards the C terminal of human USP9X. Synthetic peptide located within the following region: SQYQQNNHVHGQPYTGPAAHHMNNPQRTGQRAQENYEGSEEVSPPQTKDQ |
Carrier-free (BSA/glycerol-free) USP9X mouse monoclonal antibody, clone OTI1D7 (formerly 1D7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) USP9X mouse monoclonal antibody, clone OTI2B4 (formerly 2B4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) USP9X mouse monoclonal antibody, clone OTI2G7 (formerly 2G7)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-USP9X Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human USP9X |
USP9X rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human USP9X |
USP9X mouse monoclonal antibody, clone OTI1D7 (formerly 1D7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USP9X mouse monoclonal antibody, clone OTI1D7 (formerly 1D7)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USP9X mouse monoclonal antibody, clone OTI2B4 (formerly 2B4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USP9X mouse monoclonal antibody, clone OTI2B4 (formerly 2B4)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USP9X mouse monoclonal antibody, clone OTI2G7 (formerly 2G7)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
USP9X mouse monoclonal antibody, clone OTI2G7 (formerly 2G7)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |