Antibodies

View as table Download

USP9X Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide of human USP9X

Rabbit Polyclonal USP9x Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Genomic peptide made to an internal region of the human Usp9X protein (within residues 1150-1300). [Swiss-Prot Q93008]

Rabbit Polyclonal Anti-USP9X Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-USP9X antibody: synthetic peptide directed towards the C terminal of human USP9X. Synthetic peptide located within the following region: SQYQQNNHVHGQPYTGPAAHHMNNPQRTGQRAQENYEGSEEVSPPQTKDQ

Carrier-free (BSA/glycerol-free) USP9X mouse monoclonal antibody, clone OTI1D7 (formerly 1D7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) USP9X mouse monoclonal antibody, clone OTI2B4 (formerly 2B4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) USP9X mouse monoclonal antibody, clone OTI2G7 (formerly 2G7)

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Rabbit Polyclonal Anti-USP9X Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human USP9X

USP9X rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human USP9X

USP9X mouse monoclonal antibody, clone OTI1D7 (formerly 1D7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

USP9X mouse monoclonal antibody, clone OTI1D7 (formerly 1D7)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

USP9X mouse monoclonal antibody, clone OTI2B4 (formerly 2B4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

USP9X mouse monoclonal antibody, clone OTI2B4 (formerly 2B4)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

USP9X mouse monoclonal antibody, clone OTI2G7 (formerly 2G7)

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

USP9X mouse monoclonal antibody, clone OTI2G7 (formerly 2G7)

Applications IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated