Antibodies

View as table Download

Rabbit Polyclonal Anti-ARC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARC antibody: synthetic peptide directed towards the N terminal of human ARC. Synthetic peptide located within the following region: ELDHRTSGGLHAYPGPRGGQVAKPNVILQIGKCRAEMLEHVRRTHRHLLA

Rabbit Polyclonal Anti-ARC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ARC antibody is: synthetic peptide directed towards the C-terminal region of Human ARC. Synthetic peptide located within the following region: RHPLPKTLEQLIQRGMEVQDDLEQAAEPAGPHLPVEDEAETLTPAPNSES

Rabbit Polyclonal Anti-ARC Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human ARC

Rabbit Polyclonal Anti-ARC Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ARC antibody: synthetic peptide directed towards the middle region of human ARC. Synthetic peptide located within the following region: ELDLPQKQGEPLDQFLWRKRDLYQTLYVDADEEEIIQYVVGTLQPKLKRF

Carrier-free (BSA/glycerol-free) ARC mouse monoclonal antibody,clone OTI2B3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ARC mouse monoclonal antibody,clone OTI2H7

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ARC Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human ARC

ARC rabbit polyclonal antibody

Applications ELISA, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human ARC

ARC Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-220 of human ARC (NP_056008.1).
Modifications Unmodified

ARC mouse monoclonal antibody,clone OTI2B3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

ARC mouse monoclonal antibody,clone OTI2H7

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated