Antibodies

View as table Download

CEBPB rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CEBPB

Rabbit Polyclonal Anti-CEBPB Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CEBPB antibody: synthetic peptide directed towards the N terminal of human CEBPB. Synthetic peptide located within the following region: AIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSDL

Rabbit Polyclonal C/EBP- beta (Thr235/188) Antibody (Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human C/EBP- beta around the phosphorylation site of Threonine 235/188
Modifications Phospho-specific

Rabbit Polyclonal Anti-CEBPB Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CEBPB Antibody: A synthesized peptide derived from human CEBPB

Rabbit polyclonal C/EBP-beta (Ab-235/188) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human C/EBP-β around the phosphorylation site of threonine 235 (P-G-T-P-S).

Rabbit Polyclonal C/EBP-beta Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against A synthesized peptide derived from human C/EBP-beta

Rabbit polyclonal anti-CEBPB antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CEBPB.

Anti-CEBPB Rabbit Polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide sequence around aa.336~340(E-P-L-L-A) derived from Human C/EBPβ.

Rabbit Polyclonal anti-CEBPB antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CEBPB antibody: synthetic peptide directed towards the C terminal of human CEBPB. Synthetic peptide located within the following region: ADAKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKS

Rabbit Polyclonal Anti-CEBPB Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CEBPB

CEBPB Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CEBPB

CEBPB rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CEBPB

C/EBPB Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 150-250 of human C/EBPB (NP_005185.2).
Modifications Unmodified

Phospho-C/EBPB-T235 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding T235 of human C/EBPB.
Modifications Phospho T235