Rabbit Polyclonal Anti-DPPA5 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DPPA5 antibody: synthetic peptide directed towards the N terminal of human DPPA5. Synthetic peptide located within the following region: MGTLPARRHIPPWVKVPEDLKDPEVFQVQTRLLKAIFGPDGSRIPYIEQV |
Carrier-free (BSA/glycerol-free) DPPA5 mouse monoclonal antibody,clone OTI2F6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
DPPA5 mouse monoclonal antibody,clone OTI2F6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
DPPA5 mouse monoclonal antibody,clone OTI2F6
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Germany
Japan
United Kingdom
China