Antibodies

View as table Download

Mouse Anti-Human CD42b Purified (100 ug)

Applications FC
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal Anti-GP1BA

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GP1BA antibody: synthetic peptide directed towards the C terminal of human GP1BA. Synthetic peptide located within the following region: RGSLPTFRSSLFLWVRPNGRVGPLVAGRRPSALSQGRGQDLLSTVSIRYS

Rabbit Polyclonal Anti-GP1BA

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GP1BA antibody is: synthetic peptide directed towards the middle region of Human GP1BA. Synthetic peptide located within the following region: TPTPKLEKLSLANNNLTELPAGLLNGLENLDTLLLQENSLYTIPKGFFGS

Rabbit Polyclonal Anti-GP1BA Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human GP1BA

GP1BA rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human GP1BA