Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Goat Polyclonal Antibody against NEDD9
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence NKPQNKCDDLDR, from the internal region of the protein sequence according to NP_006394.1; NP_892011.2. |
Rabbit Polyclonal Anti-NEDD9 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NEDD9 antibody: synthetic peptide directed towards the middle region of human NEDD9. Synthetic peptide located within the following region: HPPPQLGQSVGSQNDAYDVPRGVQFLEPPAETSEKANPQERDGVYDVPLH |
Rabbit Polyclonal Anti-NEDD9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NEDD9 antibody: synthetic peptide directed towards the middle region of human NEDD9. Synthetic peptide located within the following region: DLVDGINRLSFSSTGSTRSNMSTSSTSSKESSLSASPAQDKRLFLDPDTA |
Carrier-free (BSA/glycerol-free) NEDD9 mouse monoclonal antibody,clone OTI6E3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) NEDD9 mouse monoclonal antibody,clone OTI3H4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-NEDD9 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human NEDD9 |
NEDD9 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-154 of human NEDD9 (NP_892011.2). |
| Modifications | Unmodified |
NEDD9 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 60-174 of human NEDD9 (NP_892011.2). |
| Modifications | Unmodified |
NEDD9 mouse monoclonal antibody,clone OTI6E3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
NEDD9 mouse monoclonal antibody,clone OTI6E3
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
NEDD9 mouse monoclonal antibody,clone OTI3H4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
NEDD9 mouse monoclonal antibody,clone OTI3H4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- NEDD9
Reactivities
- Human
Conjugates
- Unconjugated