Antibodies

Jump to Filters
View as table Download
nkx6.3 (NKX6-3) Rabbit Polyclonal Antibody
TA316178

USD 345.00

In Stock

Rabbit polyclonal anti-NKX6.3 antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NKX6.3.
nkx6.3 (NKX6-3) Rabbit Polyclonal Antibody
TA345550

USD 410.00

5 Days

Rabbit Polyclonal Anti-NKX6-3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NKX6-3 antibody: synthetic peptide directed towards the N terminal of human NKX6-3. Synthetic peptide located within the following region: RLCSGPWGLPELQPAAPSSSAAQLPWGESWGEEADTPACLSASGVWFQNR
nkx6.3 (NKX6-3) Rabbit Polyclonal Antibody
TA345551

USD 475.00

5 Days

Rabbit Polyclonal Anti-NKX6-3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NKX6-3 antibody: synthetic peptide directed towards the middle region of human NKX6-3. Synthetic peptide located within the following region: EPSSSTPRAPGGAGAGAGGDRAPSENEDDEYNKPLDPDSDDEKIRLLLRK
nkx6.3 (NKX6-3) Rabbit Polyclonal Antibody
TA347512

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-NKX6.3 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NKX6.3 Antibody: A synthesized peptide derived from human NKX6.3
nkx6.3 (NKX6-3) Rabbit Polyclonal Antibody
TA324622

USD 450.00

5 Days

Rabbit polyclonal NKX6-3 Antibody (Center)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This NKX6-3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 83-109 amino acids from the Central region of human NKX6-3.
nkx6.3 (NKX6-3) Rabbit Polyclonal Antibody
TA355675

USD 360.00

5 Days

NKX6-3 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human NKX6-3