Antibodies

View as table Download

Rabbit Polyclonal Anti-RNF113B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RNF113B antibody: synthetic peptide directed towards the C terminal of human RNF113B. Synthetic peptide located within the following region: HYFCESCALEHFRATPRCYICDQPTGGIFNPAKELMAKLQKLQAAEGKKR

Rabbit polyclonal anti-RNF113B antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human RNF113B.

Rabbit Polyclonal Anti-RNF113B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RNF113B antibody: synthetic peptide directed towards the middle region of human RNF113B. Synthetic peptide located within the following region: MGATADFEQDTEKEHHTPTILKCSQRVQEALRGREHDHIYRGIHSYLRYL

Rabbit Polyclonal Anti-RNF113B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RNF113B antibody: synthetic peptide directed towards the middle region of human RNF113B. Synthetic peptide located within the following region: HDHIYRGIHSYLRYLKPKDTSMGNSSSGMARKGPIRAPGHLRATVRWDYQ

Carrier-free (BSA/glycerol-free) RNF113B mouse monoclonal antibody, clone OTI7A1 (formerly 7A1)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) RNF113B mouse monoclonal antibody, clone OTI2H5 (formerly 2H5)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) RNF113B mouse monoclonal antibody, clone OTI2A6 (formerly 2A6)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) RNF113B mouse monoclonal antibody, clone OTI2C10 (formerly 2C10)

Applications FC, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) RNF113B mouse monoclonal antibody, clone OTI1B10 (formerly 1B10)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

RNF113B mouse monoclonal antibody, clone OTI7A1 (formerly 7A1)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

RNF113B mouse monoclonal antibody, clone OTI7A1 (formerly 7A1)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

RNF113B mouse monoclonal antibody, clone OTI2H5 (formerly 2H5)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

RNF113B mouse monoclonal antibody, clone OTI2H5 (formerly 2H5)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

RNF113B mouse monoclonal antibody, clone OTI2A6 (formerly 2A6)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

RNF113B mouse monoclonal antibody, clone OTI2A6 (formerly 2A6)

Applications FC, WB
Reactivities Human
Conjugation Unconjugated

RNF113B mouse monoclonal antibody, clone OTI2C10 (formerly 2C10)

Applications FC, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

RNF113B mouse monoclonal antibody, clone OTI2C10 (formerly 2C10)

Applications FC, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

RNF113B mouse monoclonal antibody, clone OTI1B10 (formerly 1B10)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

RNF113B mouse monoclonal antibody, clone OTI1B10 (formerly 1B10)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated