Rabbit Polyclonal SCO1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | SCO1 antibody was raised against a 14 amino acid peptide from near the center of human SCO1. |
Rabbit Polyclonal SCO1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | SCO1 antibody was raised against a 14 amino acid peptide from near the center of human SCO1. |
Rabbit polyclonal Anti-SCO1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SCO1 antibody: synthetic peptide directed towards the middle region of human SCO1. Synthetic peptide located within the following region: ALLAGMKHVKKEKAEKLEKERQRHIGKPLLGGPFSLTTHTGERKTDKDYL |
SCO1 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human SCO1 |
SCO1 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human SCO1 (NP_004580.1). |
Modifications | Unmodified |