SCO1 Rabbit Polyclonal Antibody

CAT#: TA342223

Rabbit polyclonal Anti-SCO1 Antibody

Product Images

WB Suggested Anti-SCO1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human heart

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-SCO1 antibody: synthetic peptide directed towards the middle region of human SCO1. Synthetic peptide located within the following region: ALLAGMKHVKKEKAEKLEKERQRHIGKPLLGGPFSLTTHTGERKTDKDYL
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: SCO1 cytochrome c oxidase assembly protein
• Database Link:
  NP_004580
  Entrez Gene 6341 Human
  UniProt ID O75880
• Background: Mammalian cytochrome c oxidase (COX) catalyzesThe transfer of reducing equivalents from cytochrome c to molecular oxygen and pumps protons acrossThe inner mitochondrial membrane. In yeast, 2 related COX assembly genes, SCO1 and SCO2 (synthesis of cytochrome c oxidase), enable subunits 1 and 2 to be incorporated intoThe holoprotein.This gene isThe human homolog toThe yeast SCO1 gene. [provided by RefSeq, Jul 2008]
• Synonyms: SCOD1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 93%; Guinea pig: 93%; Yeast: 91%