Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal Anti-SCO1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SCO1 antibody: synthetic peptide directed towards the middle region of human SCO1. Synthetic peptide located within the following region: ALLAGMKHVKKEKAEKLEKERQRHIGKPLLGGPFSLTTHTGERKTDKDYL |
SCO1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C-terminal region of Human SCO1 |
SCO1 Antibody - middle region
| Applications | WB |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of mouse SCO1 |
SCO1 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human SCO1 (NP_004580.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- SCO1