TBC1D4 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human TBC1D4 |
TBC1D4 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human TBC1D4 |
Goat Polyclonal Antibody against TBC1D4
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-DDPEKIEERKKSK, from the internal region of the protein sequence according to NP_055647.2. |
Rabbit Polyclonal TBC1D4 Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | TBC1D4 antibody was raised against an 19 amino acid peptide near the carboxy terminus of human TBC1D4 . |
Rabbit Polyclonal Anti-TBC1D4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TBC1D4 antibody is: synthetic peptide directed towards the C-terminal region of Human TBC1D4. Synthetic peptide located within the following region: EMEKIITQVFEMDISKQLHAYEVEYHVLQDELQESSYSCEDSETLEKLER |
Carrier-free (BSA/glycerol-free) TBC1D4 mouse monoclonal antibody, clone OTI5E6 (formerly 5E6)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) TBC1D4 mouse monoclonal antibody, clone OTI5A6 (formerly 5A6)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-TBC1D4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human TBC1D4 |
Phospho-TBC1D4-S588 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic phosphorylated peptide around S588 of human TBC1D4 (NP_055647.2). |
Modifications | Phospho S588 |
Phospho-TBC1D4-T642 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic phosphorylated peptide around T642 of human TBC1D4 (NP_055647.2). |
Modifications | Phospho T642 |
TBC1D4 (phospho-T642) polyclonal antibody
Applications | WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic phosphopeptide derived from human TBC1D4 around the phosphorylation site of Threonine 642. |
TBC1D4 phospho T642 Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | TBC1D4 [p Thr642] affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide surrounding the pT649 site of human TBC1D4 [p Thr642]. |
TBC1D4 mouse monoclonal antibody, clone OTI5E6 (formerly 5E6)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
TBC1D4 mouse monoclonal antibody, clone OTI5E6 (formerly 5E6)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
TBC1D4 mouse monoclonal antibody, clone OTI5A6 (formerly 5A6)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
TBC1D4 mouse monoclonal antibody, clone OTI5A6 (formerly 5A6)
Applications | FC, IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |