Antibodies

View as table Download

Rabbit Polyclonal Anti-YARS2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-YARS2 Antibody is: synthetic peptide directed towards the C-terminal region of Human YARS2. Synthetic peptide located within the following region: QPDDSVERYLKLFTFLPLPEIDHIMQLHVKEPERRGPQKRLAAEVTKLVH

Rabbit Polyclonal Anti-YARS2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human YARS2

YARS2 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human YARS2

YARS2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 228-477 of human YARS2 (NP_001035526.1).
Modifications Unmodified