YARS2 Rabbit Polyclonal Antibody

CAT#: TA332234

Rabbit Polyclonal Anti-YARS2 Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "YARS2"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for Anti-YARS2 Antibody is: synthetic peptide directed towards the C-terminal region of Human YARS2. Synthetic peptide located within the following region: QPDDSVERYLKLFTFLPLPEIDHIMQLHVKEPERRGPQKRLAAEVTKLVH
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 52 kDa
Gene Name tyrosyl-tRNA synthetase 2
Background This gene encodes a mitochondrial protein that catalyzes the attachment of tyrosine to tRNA(Tyr). Mutations in this gene are associated with myopathy with lactic acidosis and sideroblastic anemia type 2 (MLASA2).
Synonyms CGI-04; MLASA2; MT-TYRRS; TYRRS
Note Immunogen sequence homology: Human: 100%; Pig: 93%; Bovine: 93%; Dog: 86%; Rat: 86%; Guinea pig: 86%; Horse: 85%; Mouse: 79%; Rabbit: 79%
Reference Data
Protein Families Druggable Genome
Protein Pathways Aminoacyl-tRNA biosynthesis

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.