Antibodies

Jump to Filters
View as table Download
FACL4 (ACSL4) Goat Polyclonal Antibody
TA311299

USD 375.00

5 Days

Goat Anti-FACL4 / ACSL4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-HYLKDIERMYGGK, from the C Terminus of the protein sequence according to NP_004449.1; NP_075266.1.
Acsl4 Rabbit Polyclonal Antibody
TA338631

USD 375.00

5 Days

Rabbit Polyclonal Anti-Acsl4 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Acsl4 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Acsl4. Synthetic peptide located within the following region: KLERFEIPIKVRLSPEPWTPETGLVTDAFKLKRKELKNHYLKDIERMYGG
FACL4 (ACSL4) Rabbit Polyclonal Antibody
TA349566

USD 345.00

In Stock

Rabbit Polyclonal Anti-ACSL4 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ACSL4
ACSL4 Rabbit Polyclonal Antibody
TA364631

USD 380.00

4 Weeks

ACSL4 rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ACSL4
FACL4 (ACSL4) Rabbit Polyclonal Antibody
TA373213

USD 275.00

3 Weeks

ACSL4 Rabbit polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-280 of human ACSL4 (NP_004449.1).
Modifications Unmodified