Antibodies

Jump to Filters
View as table Download
BAP31 (BCAP31) Rabbit Polyclonal Antibody
TA306278

USD 430.00

5 Days

Rabbit Polyclonal BAP31 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen BAP31 antibody was raised against a 17 amino acid peptide from near the carboxy terminus of human BAP31.
BAP31 (BCAP31) Rabbit Polyclonal Antibody
TA306283

USD 430.00

5 Days

Rabbit Polyclonal BAP31 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen BAP31 antibody was raised against a 17 amino acid peptide from near the center of human BAP31.
BAP31 (BCAP31) Rabbit Polyclonal Antibody
TA339025

USD 375.00

5 Days

Rabbit Polyclonal Anti-BCAP31 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-BCAP31 antibody: synthetic peptide directed towards the middle region of human BCAP31. Synthetic peptide located within the following region: STKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPMDKKEE
BAP31 (BCAP31) Rabbit Polyclonal Antibody
TA349702

USD 345.00

In Stock

Rabbit Polyclonal Anti-BCAP31 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human BCAP31
BAP31 (BCAP31) Rabbit Polyclonal Antibody
TA373950

USD 220.00

3 Weeks

BAP31 Rabbit polyclonal Antibody

Applications IF, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 127-246 of human BAP31 (NP_001243376.1).
Modifications Unmodified