Antibodies

Jump to Filters
View as table Download
DNAJC12 Rabbit Polyclonal Antibody
TA344721

USD 475.00

5 Days

Rabbit Polyclonal Anti-DNAJC12 Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Dnajc12 antibody is synthetic peptide directed towards the middle region of Mouse Dnajc12. Synthetic peptide located within the following region: LAEFKIRALECHPDKHPENSKAVETFQKLQKAKEILCNAESRARYDHWRR
DNAJC12 Rabbit Polyclonal Antibody
TA366152

USD 380.00

4 Weeks

DNAJC12 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human DNAJC12