Rabbit Polyclonal Anti-Ehf Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Ehf antibody: synthetic peptide directed towards the N terminal of mouse Ehf. Synthetic peptide located within the following region: SCIPFQEFDISGEHLCSMSLQEFTRAAGSAGQLLYSNLQHLKWNGQCSSD |
Rabbit Polyclonal Anti-Ehf Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Ehf antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: LFQSAHNVIVKTEQTDPSIMNTWKEENYLYDPSYGSTVDLLDSKTFCRAQ |
EHF Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-210 of human EHF (NP_036285.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
