Anti-SAA1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 19-122 amino acids of human serum amyloid A1 |
Anti-SAA1 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 19-122 amino acids of human serum amyloid A1 |
Rabbit Polyclonal Anti-Saa1 Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-Saa1 antibody is: synthetic peptide directed towards the middle region of Mouse Saa1. Synthetic peptide located within the following region: DKYFHARGNYDAAQRGPGGVWAAEKISDGREAFQEFFGRGHEDTIADQEA |
SAA1 Rabbit polyclonal Antibody
Applications | IHC, WB |
Reactivities | Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human SAA1 (NP_000322.2). |
Modifications | Unmodified |