Rabbit Polyclonal Anti-TAF1B Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TAF1B antibody: synthetic peptide directed towards the C terminal of mouse TAF1B. Synthetic peptide located within the following region: YQFILNIFSFLLRIKTSALHEEVSLLEKKLFEKKYNESKKSSGSKKGRRH |
Rabbit Polyclonal Anti-Taf1b Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Taf1b antibody: synthetic peptide directed towards the middle region of mouse Taf1b. Synthetic peptide located within the following region: KYDVQAMAVIVVVLKLLFLLDDKLEWSYSDLAEAYNEQHREDTPQFDFRK |
TAF1B Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 369-588 of human TAF1B (NP_005671.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
