Rabbit Polyclonal Anti-COPS3 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-COPS3 Antibody: A synthesized peptide derived from human COPS3 |
Rabbit Polyclonal Anti-COPS3 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-COPS3 Antibody: A synthesized peptide derived from human COPS3 |
Rabbit polyclonal anti-JAB1 / COPS3 antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human JAB1. |
Goat Anti-COPS3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-SLYKKNIQRLT, from the internal region of the protein sequence according to NP_003644.2. |
Rabbit Polyclonal Anti-COPS3 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Cops3 antibody is: synthetic peptide directed towards the C-terminal region of Rat Cops3. Synthetic peptide located within the following region: NIQRLTKTFLTLSLQDMASRVQLSGPQEAEKYVLHMIEDGEIFASINQKD |
Carrier-free (BSA/glycerol-free) COPS3 mouse monoclonal antibody,clone OTI3E1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
COPS3 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human COPS3 |
COPS3 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human COPS3 |
COPS3 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 194-423 of human COPS3 (NP_003644.2). |
Modifications | Unmodified |
COPS3 mouse monoclonal antibody,clone OTI3E1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
COPS3 mouse monoclonal antibody,clone OTI3E1
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".