Mouse Monoclonal Anti-Chapsyn-110 Antibody
Applications | WB |
Reactivities | Human (weak), Mouse, Rat |
Conjugation | Unconjugated |
Mouse Monoclonal Anti-Chapsyn-110 Antibody
Applications | WB |
Reactivities | Human (weak), Mouse, Rat |
Conjugation | Unconjugated |
Rabbit polyclonal Anti-Chapsyn 110
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | GST fusion protein with a sequence VEDDYTRPPEPVYSTVNKLCDKPASPRHYSPVECDKSFLLSTPY, corresponding to amino acid residues 336-379 of rat chapsyn-110. Between PDZ2 and PDZ3 domains. |
Phospho-PSD93/chapsyn-110/DLG2-Y340 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A phospho synthetic peptide corresponding to residues surrounding Y340 of human PSD93/chapsyn-110/DLG2. |
Modifications | Phospho Y340 |
PSD93 Rabbit polyclonal Antibody
Applications | FC, IP, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthesized peptide derived from human PSD93 |