Antibodies

Jump to Filters
View as table Download
Dlg2 Mouse Monoclonal Antibody [Clone ID: S18-30]
TA326525

USD 410.00

5 Days

Mouse Monoclonal Anti-Chapsyn-110 Antibody

Applications WB
Reactivities Human (weak), Mouse, Rat
Conjugation Unconjugated
Dlg2 Rabbit Polyclonal Antibody
TA329012

USD 585.00

3 Weeks

Rabbit polyclonal Anti-Chapsyn 110

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen GST fusion protein with a sequence VEDDYTRPPEPVYSTVNKLCDKPASPRHYSPVECDKSFLLSTPY, corresponding to amino acid residues 336-379 of rat chapsyn-110. Between PDZ2 and PDZ3 domains.
PSD93 (DLG2) Rabbit Polyclonal Antibody
TA375490

USD 300.00

3 Weeks

Phospho-PSD93/chapsyn-110/DLG2-Y340 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A phospho synthetic peptide corresponding to residues surrounding Y340 of human PSD93/chapsyn-110/DLG2.
Modifications Phospho Y340
PSD93 (DLG2) Rabbit Polyclonal Antibody
TA384109

USD 380.00

4 Weeks

PSD93 Rabbit polyclonal Antibody

Applications FC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human PSD93