Antibodies

Jump to Filters
View as table Download
St8sia4 Rabbit Polyclonal Antibody
TA346744

USD 475.00

5 Days

Rabbit Polyclonal Anti-St8sia4 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for Anti-St8sia4 antibody is: synthetic peptide directed towards the C-terminal region of Rat St8sia4. Synthetic peptide located within the following region: GFWPFPKDLNGKAVKYHYYDDLKYRYFSNASPHRMPLEFKTLNVLHNRGA
ST8SIA4 Rabbit Polyclonal Antibody
TA366129

USD 380.00

4 Weeks

ST8SIA4 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ST8SIA4
ST8SIA4 Rabbit Polyclonal Antibody
TA370482

USD 380.00

4 Weeks

ST8SIA4 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human ST8SIA4