Antibodies

Jump to Filters
View as table Download
Centaurin gamma 1 (AGAP2) Rabbit Polyclonal Antibody
TA371298

USD 380.00

4 Weeks

AGAP2 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human AGAP2
Centaurin gamma 1 (AGAP2) Rabbit Polyclonal Antibody
TA351073

USD 345.00

In Stock

Rabbit Polyclonal Anti-AGAP2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human AGAP2
Centaurin gamma 1 (AGAP2) Rabbit Polyclonal Antibody
TA306168

USD 430.00

5 Days

Rabbit Polyclonal PIKE Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen PIKE antibody was raised against a peptide corresponding to 15 amino acids near the C-terminus of human PIKE.
Centaurin gamma 1 (AGAP2) Goat Polyclonal Antibody
TA305917

USD 375.00

5 Days

Goat Anti-CENTG1 / PIKE Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QASLDSIREAVINSQ, from the internal region of the protein sequence according to NP_055585.1.
Centaurin gamma 1 (AGAP2) Rabbit Polyclonal Antibody
TA319357

USD 530.00

5 Days

Rabbit polyclonal anti-AGAP2 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This protein A purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a recombinant protein corresponding to amino acids 1-836 of human AGAP2 protein.
Centaurin gamma 1 (AGAP2) Rabbit Polyclonal Antibody
TA340181

USD 375.00

5 Days

Rabbit Polyclonal Anti-CENTG1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CENTG1 antibody: synthetic peptide directed towards the middle region of human CENTG1. Synthetic peptide located within the following region: AHARHGPLDTSVEDPQLRSPLHLAAELAHVVITQLLLWYGADVAARDAQG