Rabbit Polyclonal Anti-Eya4 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Eya4 antibody is: synthetic peptide directed towards the N-terminal region of Eya4. Synthetic peptide located within the following region: MEDTQDLNEQSVKKTCPEADVSEPQNSRSMEMQDLASPHALVGGSDTPGS |
EYA4 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human EYA4 |
EYA4 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human EYA4 |
EYA4 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human EYA4 |
EYA4 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human EYA4 |
Germany
Japan
United Kingdom
China