Eya4 Rabbit Polyclonal Antibody

CAT#: TA345588

Rabbit Polyclonal Anti-Eya4 Antibody

Product Images

WB Suggested Anti-Eya4 Antibody; Titration: 1.0 ug/ml; Positive Control: Mouse Thymus

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-Eya4 antibody is: synthetic peptide directed towards the N-terminal region of Eya4. Synthetic peptide located within the following region: MEDTQDLNEQSVKKTCPEADVSEPQNSRSMEMQDLASPHALVGGSDTPGS
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 67 kDa
• Gene Name: EYA transcriptional coactivator and phosphatase 4
• Database Link:
  NP_034297
  Entrez Gene 14051 Mouse
  UniProt ID Q9Z191
• Background: Eya4 is a tyrosine phosphatase that specifically dephosphorylates 'Tyr-142' of histone H2AX (H2AXY142ph). 'Tyr-142' phosphorylation of histone H2AX plays a central role in DNA repair and acts as a mark that distinguishes between apoptotic and repair responses to genotoxic stress. Eya4 promotes efficient DNA repair by dephosphorylating H2AX, promoting the recruitment of DNA repair complexes containing MDC1. Its function as histone phosphatase probably explains its role in transcription regulation during organogenesis. It may be involved in development of the eye.
• Synonyms: CMD1J; DFNA10
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%; Zebrafish: 85%