Rabbit polyclonal Keratin 15 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Keratin 15. |
Rabbit polyclonal Keratin 15 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human Keratin 15. |
Rabbit Polyclonal Anti-Keratin 15 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Keratin 15 Antibody: A synthesized peptide derived from human Keratin 15 |
Rabbit Polyclonal Anti-KRT15 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-KRT15 antibody: synthetic peptide directed towards the C terminal of human KRT15. Synthetic peptide located within the following region: RSLLEGQDAKMAGIGIREASSGGGGSSSNFHINVEESVDGQVVSSHKREI |
Mouse monoclonal Anti-Keratin15 Clone LHK15
Reactivities | Bovine, Human, Mouse, Rat |
Conjugation | Unconjugated |
Anti-KRT15 Rabbit Polyclonal Antibody
Applications | ELISA, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of Human Keratin, type I cytoskeletal 15 |
Anti-KRT15 Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 300 amino acids of Human Keratin, type I cytoskeletal 15 |
Cytokeratin 15 (KRT15) Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 360-450 of human Cytokeratin 15 (Cytokeratin 15 (KRT15)) (NP_002266.2). |
Modifications | Unmodified |
USD 380.00
4 Weeks
Cytokeratin 15 (2G8) Mouse monoclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |