Cytokeratin 15 (KRT15) Rabbit Polyclonal Antibody

CAT#: TA330309

Rabbit Polyclonal Anti-KRT15 Antibody

Product Images

WB Suggested Anti-KRT15 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:62500; Positive Control: Human brain

• 

  WB Suggested Anti-KRT15 Antibody Titration: 4.0-8.0; Positive Control: Human Intestine

Specifications

Product Data

• Applications: IHC, WB
• Recommended Dilution: WB, IHC
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-KRT15 antibody: synthetic peptide directed towards the C terminal of human KRT15. Synthetic peptide located within the following region: RSLLEGQDAKMAGIGIREASSGGGGSSSNFHINVEESVDGQVVSSHKREI
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 49 kDa
• Gene Name: keratin 15
• Database Link:
  NP_002266
  Entrez Gene 3866 Human
  UniProt ID P19012
• Background: The protein encoded by KRT15 is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains and are clustered in a region on chromosome 17q21.2. The protein encoded by this gene is a member of the keratin gene family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Most of the type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains and are clustered in a region on chromosome 17q21.2. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Synonyms: CK15; K1CO; K15
• Note: Immunogen sequence homology: Human: 100%; Bovine: 86%; Mouse: 86%