Germany
Japan
United Kingdom
China
Rabbit Polyclonal MEIS1 Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the Middle Region of the target protein. |
Antibodies
View as table Download
Goat Anti-MEIS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-SEDITRSANLTDQ, from the internal region of the protein sequence according to NP_002389.1. |
Rabbit Polyclonal Anti-MEIS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MEIS1 antibody: synthetic peptide directed towards the middle region of human MEIS1. Synthetic peptide located within the following region: GKMPIDLVIDDREGGSKSDSEDITRSANLTDQPSWNRDHDDTASTRSGGT |
Rabbit Polyclonal Anti-MEIS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-MEIS1 Antibody: synthetic peptide directed towards the C terminal of human MEIS1. Synthetic peptide located within the following region: AVSQGTPYNPDGQPMGGFVMDGQQHMGIRAPGPMSGMGMNMGMEGQWHYM |
Carrier-free (BSA/glycerol-free) MEIS1 mouse monoclonal antibody,clone OTI3F12
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Meis1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
MEIS1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide of human MEIS1. |
MEIS1 mouse monoclonal antibody,clone OTI3F12
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
MEIS1 mouse monoclonal antibody,clone OTI3F12
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- MEIS1
Conjugates
- Unconjugated