Antibodies

Jump to Filters
View as table Download
ARH3 (ADPRHL2) Rabbit Polyclonal Antibody
TA350881

USD 345.00

In Stock

Rabbit Polyclonal Anti-ADPRHL2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human ADPRHL2
ARH3 (ADPRHL2) Rabbit Polyclonal Antibody
TA331306

USD 375.00

5 Days

Rabbit Polyclonal Anti-ADPRHL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ADPRHL2 antibody is: synthetic peptide directed towards the C-terminal region of Human ADPRHL2. Synthetic peptide located within the following region: SVLDARELGMEERPYSSRLKKIGELLDQASVTREEVVSELGNGIAAFESV