Antibodies

Jump to Filters
View as table Download
ANK1 Rabbit Monoclonal Antibody [Clone ID: OTIR3A12]
TA591034

USD 428.00

In Stock

Rabbit monoclonal anti-ANK1 antibody for SISCAPA, clone OTIR3A12

Applications SISCAPA
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
ANK1 Rabbit Polyclonal Antibody
TA344171

USD 410.00

5 Days

Rabbit Polyclonal Anti-ANK1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ANK1 antibody: synthetic peptide directed towards the C terminal of human ANK1. Synthetic peptide located within the following region: VVRQIDLSSADAAQEHEEVELRGSGLQPDLIEGRKGAQIVKRASLKRGKQ
ANK1 Rabbit Polyclonal Antibody
TA346151

USD 475.00

5 Days

Rabbit Polyclonal Anti-ANK1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ANK1 antibody: synthetic peptide directed towards the middle region of human ANK1. Synthetic peptide located within the following region: PCAMPETVVIRSEEQEQASKEYDEDSLIPSSPATETSDNISPVASPVHTG