Antibodies

View as table Download

CLDN16 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CLDN16

Rabbit Polyclonal Anti-CLDN16 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CLDN16 antibody: synthetic peptide directed towards the C terminal of human CLDN16. Synthetic peptide located within the following region: FLAGAVLTCCLYLFKDVGPERNYPYSLRKAYSAAGVSMAKSYSAPRTETA

Rabbit Polyclonal Anti-CLDN16 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-CLDN16 antibody: synthetic peptide directed towards the C terminal of human CLDN16. Synthetic peptide located within the following region: FLAGAVLTCCLYLFKDVGPERNYPYSLRKAYSAAGVSMAKSYSAPRTETA

CLDN16 rabbit polyclonal antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human CLDN16

CLDN16 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 50-150 of human CLDN16 (NP_006571.1).
Modifications Unmodified