CLDN16 Rabbit Polyclonal Antibody

CAT#: TA334205

Rabbit Polyclonal Anti-CLDN16 Antibody

Product Images

WB Suggested Anti-CLDN16 Antibody; Titration: 1.25 ug/ml; Positive Control: Fetal kidney

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human, Mouse
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-CLDN16 antibody: synthetic peptide directed towards the C terminal of human CLDN16. Synthetic peptide located within the following region: FLAGAVLTCCLYLFKDVGPERNYPYSLRKAYSAAGVSMAKSYSAPRTETA
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 34 kDa
• Gene Name: claudin 16
• Database Link:
  NP_006571
  Entrez Gene 114141 MouseEntrez Gene 10686 Human
  UniProt ID Q9Y5I7
• Background: Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. The protein encoded by this gene, a member of the claudin family, is an integral membrane protein and a component of tight junction strands. It is found primarily in the kidneys, specifically in the thick ascending limb of Henle, where it acts as either an intercellular pore or ion concentration sensor to regulate the paracellular resorption of magnesium ions. Defects in this gene are a cause of primary hypomagnesemia, which is characterized by massive renal magnesium wasting with hypomagnesemia and hypercalciuria, resulting in nephrocalcinosis and renal failure.
• Synonyms: HOMG3; PCLN1
• Note: Immunogen Sequence Homology: Human: 100%; Horse: 93%; Rabbit: 93%; Dog: 86%; Pig: 86%; Rat: 86%; Mouse: 86%; Bovine: 86%

Reference Data

• Protein Families: Druggable Genome, Transmembrane
• Protein Pathways: Cell adhesion molecules (CAMs), Leukocyte transendothelial migration, Tight junction