Rabbit polyclonal IL-8R beta/CDw128 beta (Ser347) antibody(Phospho-specific)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IL-8R beta/CDw128 beta around the phosphorylation site of serine 347 (R-P-SP-F-V). |
| Modifications | Phospho-specific |
Goat Anti-CD128 / Cxcr2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence EFKVDKFNIED-C, from the N Terminus of the protein sequence according to NP_034039.1. |
Rabbit Polyclonal Anti-IL8RB Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IL8RB antibody: synthetic peptide directed towards the N terminal of human IL8RB. Synthetic peptide located within the following region: MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYF |
Mouse Anti-Human CD182 (CXCR2) Purified (100 ug)
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal IL-8R beta/CDw128 beta (Ser347) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human IL-8R beta/CDw128 beta around the phosphorylation site of Serine 347 |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CXCR2 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CXCR2 antibody was raised against synthetic 16 amino acid peptide from N-terminal extracellular domain of human CXCR2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gorilla (100%); Monkey (88%). |
Rabbit Polyclonal Anti-CXCR2 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CXCR2 antibody was raised against synthetic 16 amino acid peptide from N-terminal extracellular domain of human CXCR2. Percent identity with other species by BLAST analysis: Human, Chimpanzee, Gibbon (100%); Gorilla (94%); Marmoset (88%). |
Anti-CXCR2 Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 18-39 amino acids of Human Chemokine (C-X-C motif) receptor 2 |
CXCR2 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of rat CXCR2 |
CXCR2 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human CXCR2 |
CXCR2 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CXCR2. |
| Modifications | Unmodified |
Recombinant Anti-IL-8RB (Clone HC2)
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Recombinant Anti-IL-8RB (Clone HC2)
| Applications | FC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Mouse IgG1 format, for improved compatibility with existing reagents, assays and techniques. |
Germany
Japan
United Kingdom
China
