Antibodies

View as table Download

CYB5R3 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CYB5R3

Goat Anti-CYB5R3 / Dia 1 (mouse) Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence PNLERVGHPKERC, from the C-Terminus of the protein sequence according to NP_084063.1.

Rabbit polyclonal anti-CYB5R3 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CYB5R3.
Modifications Phospho-specific

Rabbit Polyclonal Anti-CYB5R3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CYB5R3 antibody: synthetic peptide directed towards the C terminal of human CYB5R3. Synthetic peptide located within the following region: IRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNKHSARFKLWYTLD

Carrier-free (BSA/glycerol-free) CYB5R3 mouse monoclonal antibody, clone OTI1E8 (formerly 1E8)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CYB5R3 mouse monoclonal antibody, clone OTI2A10 (formerly 2A10)

Applications FC, IHC, WB
Reactivities Human, Monkey, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) CYB5R3 mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

CYB5R3 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CYB5R3

CYB5R3 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 125-334 of human CYB5R3 (NP_001165131.1).
Modifications Unmodified

CYB5R3 mouse monoclonal antibody, clone OTI1E8 (formerly 1E8)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

CYB5R3 mouse monoclonal antibody, clone OTI1E8 (formerly 1E8)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

CYB5R3 mouse monoclonal antibody, clone OTI2A10 (formerly 2A10)

Applications FC, IHC, WB
Reactivities Human, Monkey, Dog
Conjugation Unconjugated

CYB5R3 mouse monoclonal antibody, clone OTI2A10 (formerly 2A10)

Applications FC, IHC, WB
Reactivities Human, Monkey, Dog
Conjugation Unconjugated

Anti-CYB5R3 mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Anti-CYB5R3 mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit Polyclonal anti-CYB5R3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human CYB5R3

Rabbit Polyclonal anti-CYB5R3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein of human CYB5R3