CYB5R3 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CYB5R3 |
CYB5R3 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CYB5R3 |
Goat Anti-CYB5R3 / Dia 1 (mouse) Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence PNLERVGHPKERC, from the C-Terminus of the protein sequence according to NP_084063.1. |
CYB5R3 rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
CYB5R3 (C-term) goat polyclonal antibody, Aff - Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Immunogen | Synthetic peptide from the C-terminus of human CYB5R3 (NP_000389.1; NP_001123291.1; NP_001165131.1). |
Rabbit polyclonal anti-CYB5R3 antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CYB5R3. |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CYB5R3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CYB5R3 antibody: synthetic peptide directed towards the C terminal of human CYB5R3. Synthetic peptide located within the following region: IRAIMKDPDDHTVCHLLFANQTEKDILLRPELEELRNKHSARFKLWYTLD |
Carrier-free (BSA/glycerol-free) CYB5R3 mouse monoclonal antibody, clone OTI1E8 (formerly 1E8)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CYB5R3 mouse monoclonal antibody, clone OTI2A10 (formerly 2A10)
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CYB5R3 mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
CYB5R3 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human CYB5R3 |
CYB5R3 Rabbit polyclonal Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 125-334 of human CYB5R3 (NP_001165131.1). |
Modifications | Unmodified |
CYB5R3 mouse monoclonal antibody, clone OTI1E8 (formerly 1E8)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
CYB5R3 mouse monoclonal antibody, clone OTI1E8 (formerly 1E8), Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
CYB5R3 mouse monoclonal antibody, clone OTI1E8 (formerly 1E8), HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
CYB5R3 mouse monoclonal antibody, clone OTI1E8 (formerly 1E8)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
CYB5R3 mouse monoclonal antibody, clone OTI2A10 (formerly 2A10)
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
CYB5R3 mouse monoclonal antibody, clone OTI2A10 (formerly 2A10), Biotinylated
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | Biotin |
CYB5R3 mouse monoclonal antibody, clone OTI2A10 (formerly 2A10), HRP conjugated
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | HRP |
CYB5R3 mouse monoclonal antibody, clone OTI2A10 (formerly 2A10)
Applications | FC, IHC, WB |
Reactivities | Human, Monkey, Dog |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Anti-CYB5R3 mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-CYB5R3 mouse monoclonal antibody, clone OTI1E3 (formerly 1E3), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
Anti-CYB5R3 mouse monoclonal antibody, clone OTI1E3 (formerly 1E3), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
Anti-CYB5R3 mouse monoclonal antibody, clone OTI1E3 (formerly 1E3)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Special Offer: Get this product for $99/€99. Use code: "Truesample".
Rabbit Polyclonal anti-CYB5R3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CYB5R3 |
Rabbit Polyclonal anti-CYB5R3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human CYB5R3 |
Special Offer: Get this product for $99/€99. Use code: "Truesample".