Rabbit polyclonal antibody to DNAJB6 (DnaJ (Hsp40) homolog, subfamily B, member 6)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment contain a sequence corresponding to a region within amino acids 1 and 116 of DNAJB6 (Uniprot ID#O75190) |
Rabbit Polyclonal Anti-DNAJB6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DNAJB6 antibody: synthetic peptide directed towards the N terminal of human DNAJB6. Synthetic peptide located within the following region: PENKEEAERKFKQVAEAYEVLSDAKKRDIYDKYGKEGLNGGGGGGSHFDS |
Carrier-free (BSA/glycerol-free) DNAJB6 mouse monoclonal antibody,clone OTI2B2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
DNAJB6 Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 177-326 of human DNAJB6 (NP_490647.1). |
| Modifications | Unmodified |
DNAJB6 Rabbit monoclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
DNAJB6 mouse monoclonal antibody,clone OTI2B2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
DNAJB6 mouse monoclonal antibody,clone OTI2B2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
