Antibodies

View as table Download

Goat Polyclonal Antibody against DPP10

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DEGHNVSEKSKYHL, from the internal region of the protein sequence according to NP_065919.2; NP_001004360.1.

Rabbit Polyclonal DPP10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide made to residues 521-539 of human DPP10.

Rabbit Polyclonal Anti-DPP10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DPP10 antibody: synthetic peptide directed towards the middle region of human DPP10. Synthetic peptide located within the following region: VNYTMQVYPDEGHNVSEKSKYHLYSTILKFFSDCLKEEISVLPQEPEEDE

Rabbit Polyclonal Anti-DPP10 Antibody (Extracellular Domain)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Dipeptidylpeptidase 10 / DPP10 antibody was raised against synthetic 14 amino acid peptide from extracellular domain of human DPP10. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Elephant, Panda, Bovine, Dog, Bat, Horse, Rabbit, Pig (100%); Mouse, Rat, Hamster (93%); Opossum, Chicken (86%).

Carrier-free (BSA/glycerol-free) DPP10 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) DPP10 mouse monoclonal antibody, clone OTI2A5 (formerly 2A5)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

DPP10 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to a sequence within amino acids 400-500 of human DPP10 (NP_001308842.1).
Modifications Unmodified

DPP10 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

DPP10 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

DPP10 mouse monoclonal antibody, clone OTI2A5 (formerly 2A5)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

DPP10 mouse monoclonal antibody, clone OTI2A5 (formerly 2A5)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated