Rabbit Polyclonal Anti-FAM117A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FAM117A Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM117A. Synthetic peptide located within the following region: SPRPNHSYIFKREPPEGCEKVRVFEEATSPGPDLAFLTSCPDKNKVHFNP |
Rabbit Polyclonal Anti-FAM117A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-FAM117A Antibody is: synthetic peptide directed towards the N-terminal region of Human FAM117A. Synthetic peptide located within the following region: SWGSTDHRKEISKLKQQLQRTKLSRSGKEKERGSPLLGDHAVRGALRASP |
FAM117A Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human FAM117A. |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China