Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-FAM3D antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human FAM3D. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-FAM3D Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FAM3D antibody: synthetic peptide directed towards the middle region of human FAM3D. Synthetic peptide located within the following region: LVASYDDPGTKMNDESRKLFSDLGSSYAKQLGFRDSWVFIGAKDLRGKSP |
FAM3D rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human FAM3D |
FAM3D Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 24-204 of human FAM3D (NP_620160.1). |
| Modifications | Unmodified |
FAM3D Rabbit polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 24-204 of human FAM3D (NP_620160.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- FAM3D
Conjugates
- Unconjugated