FAM3D Rabbit Polyclonal Antibody

CAT#: TA340317

Rabbit Polyclonal Anti-FAM3D Antibody

Product Images

WB Suggested Anti-FAM3D Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 1562500; Positive Control: Jurkat cell lysate

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FAM3D antibody: synthetic peptide directed towards the middle region of human FAM3D. Synthetic peptide located within the following region: LVASYDDPGTKMNDESRKLFSDLGSSYAKQLGFRDSWVFIGAKDLRGKSP
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 25
• Gene Name: family with sequence similarity 3 member D
• Database Link:
  NP_620160
  Entrez Gene 131177 Human
  UniProt ID Q96BQ1
• Background: The function of this protein remains unknown.
• Synonyms: EF7; OIT1
• Note: Immunogen Sequence Homology: Human: 100%; Rat: 92%; Dog: 85%; Pig: 85%; Horse: 85%; Bovine: 85%; Guinea pig: 85%; Rabbit: 79%; Mouse: 77%

Reference Data

• Protein Families: Secreted Protein, Transmembrane