Rabbit Polyclonal Anti-Fzr1
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Fzr1 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: RQIIIQNENTVPCVSEMRRTLTPANSPVSSPSKHGDRFIPSRAGANWSVN |
Rabbit Polyclonal Anti-FZR1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZR1 antibody: synthetic peptide directed towards the N terminal of human FZR1. Synthetic peptide located within the following region: SSPVSSPSKHGDRFIPSRAGANWSVNFHRINENEKSPSQNRKAKDATSDN |
FZR1 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human FZR |
FZR1 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 224-493 of human FZR1 (NP_057347.2). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
