FZR1 Rabbit Polyclonal Antibody

CAT#: TA339173

Rabbit Polyclonal Anti-FZR1

Product Images

Host: Rabbit; Target Name: FZR1; Sample Tissue: Human Adult Placenta; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: FZR1; Sample Tissue: Human Fetal Lung; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: FZR1; Sample Tissue: Human Fetal Heart; Antibody Dilution: 1.0 ug/ml

• 

  Host: Rabbit; Target Name: FZR1; Sample Tissue: Human Fetal Brain; Antibody Dilution: 1.0 ug/ml

• 

  WB Suggested Anti-FZR1 Antibody Titration: 0.2-1 ug/ml; Positive Control: 721_B cell lysate FZR1 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells

Show all 5 images

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for anti-FZR1 antibody: synthetic peptide directed towards the N terminal of human FZR1. Synthetic peptide located within the following region: SSPVSSPSKHGDRFIPSRAGANWSVNFHRINENEKSPSQNRKAKDATSDN
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Concentration: lot specific
• Purification: Protein A purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 55 kDa
• Gene Name: fizzy/cell division cycle 20 related 1
• Database Link:
  NP_057347
  Entrez Gene 51343 Human
  UniProt ID Q9UM11
• Background: FZR1 is a key regulator of ligase activity of the anaphase promoting complex/cyclosome (APC/C), which confers substrate specificity upon the complex. FZR1 associates with the APC/C in late mitosis, in replacement of CDC20, and activates the APC/C during anaphase and telophase. The APC/C remains active in degrading substrates to ensure that positive regulators of the cell cycle do not accumulate prematurely. At the G1/S transition FZR1 is phosphorylated, leading to its dissociation from the APC/C. Following DNA damage, it is required for the G2 DNA damage checkpoint: its dephosphorylation and reassociation with the APC/C leads to the ubiquitination of PLK1, preventing entry into mitosis.
• Synonyms: CDC20C; CDH1; FZR; FZR2; HCDH; HCDH1
• Note: Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Zebrafish: 100%; Guinea pig: 100%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Cell cycle, Progesterone-mediated oocyte maturation, Ubiquitin mediated proteolysis