Antibodies

Jump to Filters
View as table Download
Mutarotase (GALM) Rabbit Polyclonal Antibody
TA340314

USD 375.00

5 Days

Rabbit Polyclonal Anti-GALM Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GALM antibody: synthetic peptide directed towards the N terminal of human GALM. Synthetic peptide located within the following region: WGCTITALEVKDRQGRASDVVLGFAELEGYLQKQPYFGAVIGRVANRIAK
Mutarotase (GALM) Rabbit Polyclonal Antibody
TA340315

USD 375.00

5 Days

Rabbit Polyclonal Anti-GALM Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GALM antibody: synthetic peptide directed towards the middle region of human GALM. Synthetic peptide located within the following region: SKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPK
Mutarotase (GALM) Mouse Monoclonal Antibody [Clone ID: OTI7B7]
CF812291

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GALM mouse monoclonal antibody,clone OTI7B7

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Mutarotase (GALM) Mouse Monoclonal Antibody [Clone ID: OTI4F4]
CF812300

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GALM mouse monoclonal antibody,clone OTI4F4

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Mutarotase (GALM) Mouse Monoclonal Antibody [Clone ID: OTI10B3]
CF812311

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GALM mouse monoclonal antibody,clone OTI10B3

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Mutarotase (GALM) Mouse Monoclonal Antibody [Clone ID: OTI2F8]
CF812316

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) GALM mouse monoclonal antibody,clone OTI2F8

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
GALM Rabbit Polyclonal Antibody
TA366499

USD 380.00

4 Weeks

GALM rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GALM
GALM Rabbit Polyclonal Antibody
TA370848

USD 380.00

4 Weeks

GALM rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human GALM
Mutarotase (GALM) Rabbit Polyclonal Antibody
TA376465

USD 220.00

3 Weeks

GALM Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-342 of human GALM (NP_620156.1).
Modifications Unmodified