Mutarotase (GALM) Rabbit Polyclonal Antibody

CAT#: TA340315

Rabbit Polyclonal Anti-GALM Antibody


USD 375.00

5 Days*

Size
    • 100 ul

Product Images

Other products for "GALM"

Specifications

Product Data
Applications WB
Recommended Dilution WB
Reactivities Human
Host Rabbit
Isotype IgG
Clonality Polyclonal
Immunogen The immunogen for anti-GALM antibody: synthetic peptide directed towards the middle region of human GALM. Synthetic peptide located within the following region: SKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPK
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Concentration lot specific
Purification Affinity Purified
Conjugation Unconjugated
Storage Store at -20°C as received.
Stability Stable for 12 months from date of receipt.
Predicted Protein Size 38
Gene Name galactose mutarotase
Background GALM is an enzyme that catalyzes the epimerization of hexose sugars such as glucose and galactose. It is expressed in the cytoplasm and has a preference for galactose. The protein may be required for normal galactose metabolism by maintaining the equilibrium of alpha and beta anomers of galactose.
Synonyms BLOCK25; GLAT; HEL-S-63p; IBD1
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Goat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Dog: 93%; Rabbit: 93%; Zebrafish: 92%
Reference Data
Protein Pathways Glycolysis / Gluconeogenesis

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.