Antibodies

Jump to Filters
View as table Download
ALF (GTF2A1L) Rabbit Polyclonal Antibody
TA331189

USD 375.00

5 Days

Rabbit Polyclonal Anti-ALF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALF antibody: synthetic peptide directed towards the N terminal of human ALF. Synthetic peptide located within the following region: VIPAGRTLPSFTTAELGTSNSSANFTFPGYPIHVPAGVTLQTVSGHLYKV
ALF (GTF2A1L) Rabbit Polyclonal Antibody
TA331190

USD 310.00

5 Days

Rabbit Polyclonal Anti-ALF Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALF antibody: synthetic peptide directed towards the N terminal of human ALF. Synthetic peptide located within the following region: VIPAGRTLPSFTTAELGTSNSSANFTFPGYPIHVPAGVTLQTVSGHLYKV
ALF (GTF2A1L) Rabbit Polyclonal Antibody
TA335367

USD 375.00

5 Days

Rabbit Polyclonal Anti-GTF2A1L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GTF2A1L Antibody: synthetic peptide directed towards the C terminal of human GTF2A1L. Synthetic peptide located within the following region: GSGDTSSNEEIGSTRDADENEFLGNIDGGDLKVPEEEADSISNEDSATNS
ALF (GTF2A1L) Rabbit Polyclonal Antibody
TA335368

USD 375.00

5 Days

Rabbit Polyclonal Anti-GTF2A1L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GTF2A1L Antibody: synthetic peptide directed towards the C terminal of human GTF2A1L. Synthetic peptide located within the following region: EFLGNIDGGDLKVPEEEADSISNEDSATNSSDNEDPQVNIVEEDPLNSGD
ALF (GTF2A1L) Rabbit Polyclonal Antibody
TA339816

USD 375.00

5 Days

Rabbit Polyclonal Anti-GTF2A1L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GTF2A1L antibody: synthetic peptide directed towards the C terminal of human GTF2A1L. Synthetic peptide located within the following region: RVTDDDIGEIIQVDGSGDTSSNEEIGSTRDADENEFLGNIDGGDLKVPEE
ALF (GTF2A1L) Mouse Monoclonal Antibody [Clone ID: OTI1D3]
CF810959

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) GTF2A1L mouse monoclonal antibody,clone OTI1D3

Applications WB
Reactivities Human
Conjugation Unconjugated
ALF (GTF2A1L) Mouse Monoclonal Antibody [Clone ID: OTI4B4]
CF810961

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) GTF2A1L mouse monoclonal antibody,clone OTI4B4

Applications WB
Reactivities Human
Conjugation Unconjugated
ALF (GTF2A1L) Mouse Monoclonal Antibody [Clone ID: OTI4B4]
TA810961

USD 379.00

In Stock

GTF2A1L mouse monoclonal antibody,clone OTI4B4

Applications WB
Reactivities Human
Conjugation Unconjugated
ALF (GTF2A1L) Mouse Monoclonal Antibody [Clone ID: OTI4B4]
TA810961S

USD 159.00

2 Days

GTF2A1L mouse monoclonal antibody,clone OTI4B4

Applications WB
Reactivities Human
Conjugation Unconjugated